Lineage for d1os1a2 (1os1 A:4-227)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011363Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1011364Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 1011365Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 1011376Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 1011377Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)
  8. 1011380Domain d1os1a2: 1os1 A:4-227 [93468]
    Other proteins in same PDB: d1os1a1
    complexed with atp, ca, mg, pyr

Details for d1os1a2

PDB Entry: 1os1 (more details), 1.8 Å

PDB Description: Structure of Phosphoenolpyruvate Carboxykinase complexed with ATP,Mg, Ca and pyruvate.
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1os1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os1a2 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d1os1a2:

Click to download the PDB-style file with coordinates for d1os1a2.
(The format of our PDB-style files is described here.)

Timeline for d1os1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1os1a1