Lineage for d1orya_ (1ory A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910544Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 910545Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
  6. 910546Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 910547Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)
  8. 910552Domain d1orya_: 1ory A: [93466]
    complexed with a flagelin fragment, chain B
    complexed with po4

Details for d1orya_

PDB Entry: 1ory (more details), 2.45 Å

PDB Description: flagellar export chaperone in complex with its cognate binding partner
PDB Compounds: (A:) flagellar protein FliS

SCOPe Domain Sequences for d1orya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orya_ a.24.19.1 (A:) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
eayfqnqvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisa
lksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevkkkv

SCOPe Domain Coordinates for d1orya_:

Click to download the PDB-style file with coordinates for d1orya_.
(The format of our PDB-style files is described here.)

Timeline for d1orya_: