Lineage for d1orjd_ (1orj D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083991Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 1083992Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
  6. 1083993Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 1083994Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)
  8. 1083998Domain d1orjd_: 1orj D: [93459]

Details for d1orjd_

PDB Entry: 1orj (more details), 2.25 Å

PDB Description: flagellar export chaperone
PDB Compounds: (D:) flagellar protein FliS

SCOPe Domain Sequences for d1orjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orjd_ a.24.19.1 (D:) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
kkvhh

SCOPe Domain Coordinates for d1orjd_:

Click to download the PDB-style file with coordinates for d1orjd_.
(The format of our PDB-style files is described here.)

Timeline for d1orjd_: