SCOP 1.73: Domain d1orjc_: 1orj C:

Lineage for d1orjc_ (1orj C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (1 family)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)

6. Protein Flagellar export chaperone FliS [101118] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)

8. Domain d1orjc_: 1orj C: [93458]

Details for d1orjc_

PDB Entry: 1orj, 2.25 Å

PDB Description: flagellar export chaperone

PDB Compounds: (C:) flagellar protein FliS

SCOP Domain Sequences for d1orjc_:

Sequence; same for both SEQRES and ATOM records:

>d1orjc_ a.24.19.1 (C:) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
pleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisalksfldhekgke
iaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk

Timeline for d1orjc_:

• d1orjc_ first appeared in SCOP 1.67
  
• d1orjc_ appears in SCOP 1.71
  
• d1orjc_ appears in SCOP 1.75
  
• d1orjc_ appears in the current release, SCOPe 2.08