Lineage for d1ooya1 (1ooy A:261-481)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630703Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1630704Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1630819Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 1630838Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species)
  7. 1630844Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries)
  8. 1630849Domain d1ooya1: 1ooy A:261-481 [93388]
    Other proteins in same PDB: d1ooya2, d1ooyb2
    complexed with k, po4

Details for d1ooya1

PDB Entry: 1ooy (more details), 1.7 Å

PDB Description: succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (A:) Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursor

SCOPe Domain Sequences for d1ooya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooya1 c.124.1.3 (A:261-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvtt

SCOPe Domain Coordinates for d1ooya1:

Click to download the PDB-style file with coordinates for d1ooya1.
(The format of our PDB-style files is described here.)

Timeline for d1ooya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ooya2