SCOPe 2.08: Domain d1ooha1: 1ooh A:1-124

Lineage for d1ooha1 (1ooh A:1-124)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d1ooha1: 1ooh A:1-124 [93383]
   Other proteins in same PDB: d1ooha2, d1oohb2
   complexed with 1bo, act

Details for d1ooha1

PDB Entry: 1ooh, 1.25 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with butanol

PDB Compounds: (A:) odorant binding protein LUSH

SCOPe Domain Sequences for d1ooha1:

Sequence; same for both SEQRES and ATOM records:

>d1ooha1 a.39.2.1 (A:1-124) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d1ooha1:

• d1ooha1 first appeared in SCOP 1.67, called d1ooha_
  
• d1ooha1 appears in SCOPe 2.07