Lineage for d1olpc2 (1olp C:250-370)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383397Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2383398Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2383463Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2383464Protein Alpha-toxin, C-terminal domain [49739] (2 species)
  7. 2383465Species Clostridium absonum [TaxId:29369] [101573] (1 PDB entry)
  8. 2383468Domain d1olpc2: 1olp C:250-370 [93325]
    Other proteins in same PDB: d1olpa1, d1olpb1, d1olpc1, d1olpd1
    complexed with ca, zn

Details for d1olpc2

PDB Entry: 1olp (more details), 2.5 Å

PDB Description: Alpha Toxin from Clostridium Absonum
PDB Compounds: (C:) alpha-toxin

SCOPe Domain Sequences for d1olpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olpc2 b.12.1.3 (C:250-370) Alpha-toxin, C-terminal domain {Clostridium absonum [TaxId: 29369]}
dkdydlneivvmiktadvqdagtdnyiyfgietkdgvkeewaldnpgndftrnqegtytl
klknkntkysdiknmwirdekltvatdgwkpsyvkviagdkvrlekninewisggttytl
k

SCOPe Domain Coordinates for d1olpc2:

Click to download the PDB-style file with coordinates for d1olpc2.
(The format of our PDB-style files is described here.)

Timeline for d1olpc2: