SCOP 1.67: Domain d1okud2: 1oku D:310-432

Lineage for d1okud2 (1oku D:310-432)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (24 PDB entries)

8. Domain d1okud2: 1oku D:310-432 [93281]
   Other proteins in same PDB: d1okua_, d1okuc_
   complexed with aba, nh2, pff

Details for d1okud2

PDB Entry: 1oku, 2.9 Å

PDB Description: cyclin a binding groove inhibitor h-ala-ala-abu-arg-er-leu-ile-(p-f-phe)-nh2

SCOP Domain Sequences for d1okud2:

Sequence; same for both SEQRES and ATOM records:

>d1okud2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1okud2:

• d1okud2 is new in SCOP 1.67
  
• d1okud2 appears in SCOP 1.69
  
• d1okud2 last appears in SCOP 1.71