Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species) |
Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries) |
Domain d1ok6e_: 1ok6 E: [93230] complexed with gol |
PDB Entry: 1ok6 (more details), 2.4 Å
SCOPe Domain Sequences for d1ok6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ok6e_ c.1.10.1 (E:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]} anltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfq rgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfew kmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikyt gdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdal kfaralaelvyg
Timeline for d1ok6e_: