Lineage for d1ok2b3 (1ok2 B:129-190)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703717Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1703718Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1703719Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1703814Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 1703815Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)
  8. 1703852Domain d1ok2b3: 1ok2 B:129-190 [93206]
    intact protein
    complexed with act, gol, so4

Details for d1ok2b3

PDB Entry: 1ok2 (more details), 2.5 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.
PDB Compounds: (B:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ok2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok2b3 g.18.1.1 (B:129-190) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

SCOPe Domain Coordinates for d1ok2b3:

Click to download the PDB-style file with coordinates for d1ok2b3.
(The format of our PDB-style files is described here.)

Timeline for d1ok2b3: