SCOP 1.73: Domain d1ok1b4: 1ok1 B:191-254

Lineage for d1ok1b4 (1ok1 B:191-254)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (15 PDB entries)

8. Domain d1ok1b4: 1ok1 B:191-254 [93199]
   intact protein
   complexed with act, gol, so4

Details for d1ok1b4

PDB Entry: 1ok1, 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

PDB Compounds: (B:) complement decay-accelerating factor

SCOP Domain Sequences for d1ok1b4:

Sequence; same for both SEQRES and ATOM records:

>d1ok1b4 g.18.1.1 (B:191-254) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crgc

Timeline for d1ok1b4:

• d1ok1b4 first appeared in SCOP 1.67
  
• d1ok1b4 appears in SCOP 1.71
  
• d1ok1b4 appears in SCOP 1.75
  
• d1ok1b4 appears in the current release, SCOPe 2.08