SCOP 1.69: Domain d1ok1b3: 1ok1 B:129-190

Lineage for d1ok1b3 (1ok1 B:129-190)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)

8. Domain d1ok1b3: 1ok1 B:129-190 [93198]

Details for d1ok1b3

PDB Entry: 1ok1, 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

SCOP Domain Sequences for d1ok1b3:

Sequence; same for both SEQRES and ATOM records:

>d1ok1b3 g.18.1.1 (B:129-190) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

Timeline for d1ok1b3:

• d1ok1b3 first appeared in SCOP 1.67
  
• d1ok1b3 appears in SCOP 1.71
  
• d1ok1b3 appears in the current release, SCOPe 2.08