SCOPe 2.08: Domain d1ojwb3: 1ojw B:129-190

Lineage for d1ojwb3 (1ojw B:129-190)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d1ojwb3: 1ojw B:129-190 [93162]
   Other proteins in same PDB: d1ojwa5
   intact protein
   complexed with gol, so4

Details for d1ojwb3

PDB Entry: 1ojw, 2.3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

PDB Compounds: (B:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ojwb3:

Sequence; same for both SEQRES and ATOM records:

>d1ojwb3 g.18.1.1 (B:129-190) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

Timeline for d1ojwb3:

• d1ojwb3 first appeared in SCOP 1.67
  
• d1ojwb3 appears in SCOPe 2.07