Class g: Small proteins [56992] (94 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries) |
Domain d1ojva2: 1ojv A:65-128 [93149] intact protein complexed with act, gol, so4 |
PDB Entry: 1ojv (more details), 2.3 Å
SCOPe Domain Sequences for d1ojva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojva2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave fckk
Timeline for d1ojva2:
View in 3D Domains from other chains: (mouse over for more information) d1ojvb1, d1ojvb2, d1ojvb3, d1ojvb4 |