Lineage for d1ojva2 (1ojv A:65-128)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749385Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 749386Species Human (Homo sapiens) [TaxId:9606] [90173] (15 PDB entries)
  8. 749402Domain d1ojva2: 1ojv A:65-128 [93149]

Details for d1ojva2

PDB Entry: 1ojv (more details), 2.3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.
PDB Compounds: (A:) complement decay-accelerating factor

SCOP Domain Sequences for d1ojva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojva2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave
fckk

SCOP Domain Coordinates for d1ojva2:

Click to download the PDB-style file with coordinates for d1ojva2.
(The format of our PDB-style files is described here.)

Timeline for d1ojva2: