Lineage for d1oh9a_ (1oh9 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004957Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1004958Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1004977Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 1004978Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 1004979Species Escherichia coli [TaxId:562] [75299] (5 PDB entries)
  8. 1004982Domain d1oh9a_: 1oh9 A: [93011]
    complexed with adp, alf, mg, nlg

Details for d1oh9a_

PDB Entry: 1oh9 (more details), 1.91 Å

PDB Description: acetylglutamate kinase from escherichia coli complexed with mgadp, n- acetyl-l-glutamate and the transition-state mimic alf4-
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d1oh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh9a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]}
mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
eqlpalfngmpmgtrila

SCOPe Domain Coordinates for d1oh9a_:

Click to download the PDB-style file with coordinates for d1oh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1oh9a_: