Lineage for d1oh8a1 (1oh8 A:270-566)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1500365Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1500366Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 1500367Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 1500368Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 1500369Species Escherichia coli [TaxId:562] [48338] (8 PDB entries)
    Uniprot P23909 2-800
  8. 1500381Domain d1oh8a1: 1oh8 A:270-566 [93003]
    Other proteins in same PDB: d1oh8a2, d1oh8a3, d1oh8a4, d1oh8b2, d1oh8b3, d1oh8b4
    complexed with adp, mg

Details for d1oh8a1

PDB Entry: 1oh8 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh8a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1oh8a1:

Click to download the PDB-style file with coordinates for d1oh8a1.
(The format of our PDB-style files is described here.)

Timeline for d1oh8a1: