Lineage for d1oh7b4 (1oh7 B:14-116)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031824Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1031855Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 1031856Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1031857Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1031858Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1031869Domain d1oh7b4: 1oh7 B:14-116 [93002]
    Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a3, d1oh7b1, d1oh7b2, d1oh7b3
    complexed with adp, mg

Details for d1oh7b4

PDB Entry: 1oh7 (more details), 2.5 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:g mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh7b4:

Sequence, based on SEQRES records: (download)

>d1oh7b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d1oh7b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp

SCOPe Domain Coordinates for d1oh7b4:

Click to download the PDB-style file with coordinates for d1oh7b4.
(The format of our PDB-style files is described here.)

Timeline for d1oh7b4: