SCOPe 2.03: Domain d1oh5b4: 1oh5 B:14-116

Lineage for d1oh5b4 (1oh5 B:14-116)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family)
   automatically mapped to Pfam PF01624

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1oh5b4: 1oh5 B:14-116 [92986]
   Other proteins in same PDB: d1oh5a1, d1oh5a2, d1oh5a3, d1oh5b1, d1oh5b2, d1oh5b3
   complexed with adp, mg

Details for d1oh5b4

PDB Entry: 1oh5, 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a c:a mismatch

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh5b4:

Sequence, based on SEQRES records:

>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records):

>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp

Timeline for d1oh5b4:

• d1oh5b4 first appeared in SCOP 1.67
  
• d1oh5b4 appears in SCOPe 2.02
  
• d1oh5b4 appears in SCOPe 2.04
  
• d1oh5b4 appears in the current release, SCOPe 2.08