| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) ![]() automatically mapped to Pfam PF01624 |
| Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
| Protein DNA repair protein MutS, domain I [55273] (2 species) |
| Species Escherichia coli [TaxId:562] [55275] (8 PDB entries) Uniprot P23909 2-800 |
| Domain d1oh5b4: 1oh5 B:14-116 [92986] Other proteins in same PDB: d1oh5a1, d1oh5a2, d1oh5a3, d1oh5b1, d1oh5b2, d1oh5b3 complexed with adp, mg |
PDB Entry: 1oh5 (more details), 2.9 Å
SCOPe Domain Sequences for d1oh5b4:
Sequence, based on SEQRES records: (download)
>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp
Timeline for d1oh5b4:
View in 3DDomains from other chains: (mouse over for more information) d1oh5a1, d1oh5a2, d1oh5a3, d1oh5a4 |