PDB entry 1oh5

View 1oh5 on RCSB PDB site
Description: the crystal structure of e. coli muts binding to DNA with a c:a mismatch
Class: DNA binding
Keywords: DNA binding, mismatch recognition
Deposited on 2003-05-23, released 2003-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein muts
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oh5a1, d1oh5a2, d1oh5a3, d1oh5a4
  • Chain 'B':
    Compound: DNA mismatch repair protein muts
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oh5b1, d1oh5b2, d1oh5b3, d1oh5b4
  • Chain 'E':
    Compound: 5'-d(*ap*gp*cp*tp*gp*cp*cp*ap*cp*gp *cp*ap*cp*cp*ap*gp*tp*gp*tp*cp*ap*gp*cp*gp*tp *cp*cp*tp*ap*t)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*ap*tp*ap*gp*gp*ap*cp*gp*cp*tp *gp*ap*cp*ap*cp*tp*gp*gp*tp*gp*cp*ap*tp*gp*gp *cp*ap*gp*cp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oh5A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oh5A (A:)
    saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
    agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtisd
    eallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaellya
    edfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcll
    qyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvtp
    mgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrtar
    prdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvrd
    ggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrgq
    shlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphlea
    lqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianpl
    nlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgfmv
    emtetanilhnateyslvlmdeigrgtstydglslawacaenlankikaltlfathyfel
    tqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqk
    lrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oh5B (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oh5B (B:)
    mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
    vnqgesvaicerkvvrivtpgtisdeallqerqdnllaaiwqdskgfgyatldissgrfr
    lsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefeidtarqqlnlq
    fgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqdsiimdaatrrn
    leitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtigalqdfta
    glqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsapvqalrek
    mgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdylerlevrere
    rtgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkeyedkvlts
    kgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytlnytcptfidkp
    giritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrqtalialmayi
    gsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeigrgtstydgls
    lawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdga
    asksyglavaalagvpkevikrarqklrelesis
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.