SCOPe 2.03: Domain d1oh1a_: 1oh1 A:

Lineage for d1oh1a_ (1oh1 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families)

5. Family b.61.2.2: Staphostatin [101869] (2 proteins)
   cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand

6. Protein Staphostatin A (SAV1910, SA1726) [101870] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101871] (1 PDB entry)

8. Domain d1oh1a_: 1oh1 A: [92977]

Details for d1oh1a_

PDB Entry: 1oh1

PDB Description: solution structure of staphostatin a form staphylococcus aureus confirms the discovery of a novel class of cysteine proteinase inhibitors.

PDB Compounds: (A:) staphostatin a

SCOPe Domain Sequences for d1oh1a_:

Sequence; same for both SEQRES and ATOM records:

>d1oh1a_ b.61.2.2 (A:) Staphostatin A (SAV1910, SA1726) {Staphylococcus aureus [TaxId: 1280]}
gsmeqfelfsidkfkcnseakyylniiegewhpqdlndsplkfilstsddsdyickyint
ehkqltlynknnssivieifipndnkilltimntealgtsprmtfikhk

Timeline for d1oh1a_:

• d1oh1a_ first appeared in SCOP 1.67
  
• d1oh1a_ appears in SCOPe 2.02
  
• d1oh1a_ appears in SCOPe 2.04
  
• d1oh1a_ appears in the current release, SCOPe 2.08