Lineage for d1oh1a_ (1oh1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806532Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2806539Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 2806540Protein Staphostatin A (SAV1910, SA1726) [101870] (1 species)
  7. 2806541Species Staphylococcus aureus [TaxId:1280] [101871] (1 PDB entry)
  8. 2806542Domain d1oh1a_: 1oh1 A: [92977]

Details for d1oh1a_

PDB Entry: 1oh1 (more details)

PDB Description: solution structure of staphostatin a form staphylococcus aureus confirms the discovery of a novel class of cysteine proteinase inhibitors.
PDB Compounds: (A:) staphostatin a

SCOPe Domain Sequences for d1oh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh1a_ b.61.2.2 (A:) Staphostatin A (SAV1910, SA1726) {Staphylococcus aureus [TaxId: 1280]}
gsmeqfelfsidkfkcnseakyylniiegewhpqdlndsplkfilstsddsdyickyint
ehkqltlynknnssivieifipndnkilltimntealgtsprmtfikhk

SCOPe Domain Coordinates for d1oh1a_:

Click to download the PDB-style file with coordinates for d1oh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1oh1a_: