| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
| Protein Periplasmic nitrate reductase subunit NapB [74805] (2 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [101503] (1 PDB entry) |
| Domain d1ogyj_: 1ogy J: [92966] Other proteins in same PDB: d1ogya1, d1ogya2, d1ogyc1, d1ogyc2, d1ogye1, d1ogye2, d1ogyg1, d1ogyg2, d1ogyi1, d1ogyi2, d1ogyk1, d1ogyk2, d1ogym1, d1ogym2, d1ogyo1, d1ogyo2 complexed with hec, mgd, mo, sf4 |
PDB Entry: 1ogy (more details), 3.2 Å
SCOPe Domain Sequences for d1ogyj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogyj_ a.138.1.3 (J:) Periplasmic nitrate reductase subunit NapB {Rhodobacter sphaeroides [TaxId: 1063]}
daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
lmpasne
Timeline for d1ogyj_: