Lineage for d1ogyb_ (1ogy B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506148Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1506149Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1506280Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 1506359Protein Periplasmic nitrate reductase subunit NapB [74805] (2 species)
  7. 1506362Species Rhodobacter sphaeroides [TaxId:1063] [101503] (1 PDB entry)
  8. 1506363Domain d1ogyb_: 1ogy B: [92954]
    Other proteins in same PDB: d1ogya1, d1ogya2, d1ogyc1, d1ogyc2, d1ogye1, d1ogye2, d1ogyg1, d1ogyg2, d1ogyi1, d1ogyi2, d1ogyk1, d1ogyk2, d1ogym1, d1ogym2, d1ogyo1, d1ogyo2
    complexed with hec, mgd, mo, sf4

Details for d1ogyb_

PDB Entry: 1ogy (more details), 3.2 Å

PDB Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides
PDB Compounds: (B:) diheme cytochrome c napb molecule: nitrate reductase

SCOPe Domain Sequences for d1ogyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogyb_ a.138.1.3 (B:) Periplasmic nitrate reductase subunit NapB {Rhodobacter sphaeroides [TaxId: 1063]}
daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
lmpasne

SCOPe Domain Coordinates for d1ogyb_:

Click to download the PDB-style file with coordinates for d1ogyb_.
(The format of our PDB-style files is described here.)

Timeline for d1ogyb_: