Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries) Uniprot P20248 175-432 |
Domain d1ogub1: 1ogu B:178-309 [92943] Other proteins in same PDB: d1ogua1, d1ogua2, d1oguc1, d1oguc2 complexed with sgm, st8 |
PDB Entry: 1ogu (more details), 2.6 Å
SCOPe Domain Sequences for d1ogub1:
Sequence, based on SEQRES records: (download)
>d1ogub1 a.74.1.1 (B:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl vlkvltfdlaap
>d1ogub1 a.74.1.1 (B:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehlvl kvltfdlaap
Timeline for d1ogub1: