Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (4 proteins) |
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) |
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries) |
Domain d1ogia2: 1ogi A:142-303 [92915] Other proteins in same PDB: d1ogia1 complexed with fad, so4; mutant |
PDB Entry: 1ogi (more details), 1.64 Å
SCOP Domain Sequences for d1ogia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogia2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} lpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
Timeline for d1ogia2: