![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
![]() | Superfamily c.133.1: RbsD-like [102546] (2 families) ![]() |
![]() | Family c.133.1.1: RbsD-like [102547] (2 proteins) automatically mapped to Pfam PF05025 |
![]() | Protein Ribose transport protein RbsD [102548] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102549] (4 PDB entries) |
![]() | Domain d1ogfe_: 1ogf E: [92907] complexed with cl, gol |
PDB Entry: 1ogf (more details), 2.3 Å
SCOPe Domain Sequences for d1ogfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogfe_ c.133.1.1 (E:) Ribose transport protein RbsD {Bacillus subtilis [TaxId: 1423]} mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy ancilqagvlf
Timeline for d1ogfe_:
![]() Domains from other chains: (mouse over for more information) d1ogfa_, d1ogfb_, d1ogfc_, d1ogfd_ |