PDB entry 1ogf

View 1ogf on RCSB PDB site
Description: The Structure of Bacillus subtilis RbsD complexed with glycerol
Class: transport
Keywords: ribose, transport, sugar transport
Deposited on 2003-04-30, released 2003-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity ribose transport protein rbsd
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ogfa_
  • Chain 'B':
    Compound: high affinity ribose transport protein rbsd
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ogfb_
  • Chain 'C':
    Compound: high affinity ribose transport protein rbsd
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ogfc_
  • Chain 'D':
    Compound: high affinity ribose transport protein rbsd
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ogfd_
  • Chain 'E':
    Compound: high affinity ribose transport protein rbsd
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ogfe_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ogfA (A:)
    mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
    emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
    ancilqagvlf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ogfB (B:)
    mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
    emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
    ancilqagvlf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ogfC (C:)
    mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
    emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
    ancilqagvlf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ogfD (D:)
    mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
    emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
    ancilqagvlf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ogfE (E:)
    mkkhgilnshlakiladlghtdkiviadaglpvpdgvlkidlslkpglpafqdtaavlae
    emavekviaaaeikasnqenakflenlfseqeieylsheefklltkdakavirtgeftpy
    ancilqagvlf