Lineage for d1oc4b2 (1oc4 B:164-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232753Species Plasmodium berghei [TaxId:5821] [103325] (1 PDB entry)
  8. 2232755Domain d1oc4b2: 1oc4 B:164-329 [92773]
    Other proteins in same PDB: d1oc4a1, d1oc4b1
    complexed with gol, nad, oxm

Details for d1oc4b2

PDB Entry: 1oc4 (more details), 2.3 Å

PDB Description: lactate dehydrogenase from plasmodium berghei
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1oc4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oc4b2 d.162.1.1 (B:164-329) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnkkit
dqeldaifdrtintaleivnlhaspyvapaaaiiemaesyirdlrkvlicstllegqygh
kdifagtplviggngveqvielqlnadekkkfdeavaetsrmkali

SCOPe Domain Coordinates for d1oc4b2:

Click to download the PDB-style file with coordinates for d1oc4b2.
(The format of our PDB-style files is described here.)

Timeline for d1oc4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oc4b1