Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (19 species) |
Species Plasmodium berghei [TaxId:5821] [103325] (1 PDB entry) |
Domain d1oc4b2: 1oc4 B:164-329 [92773] Other proteins in same PDB: d1oc4a1, d1oc4b1 complexed with gol, nad, oxm |
PDB Entry: 1oc4 (more details), 2.3 Å
SCOPe Domain Sequences for d1oc4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oc4b2 d.162.1.1 (B:164-329) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]} ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnkkit dqeldaifdrtintaleivnlhaspyvapaaaiiemaesyirdlrkvlicstllegqygh kdifagtplviggngveqvielqlnadekkkfdeavaetsrmkali
Timeline for d1oc4b2: