Lineage for d1obla_ (1obl A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011723Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1011724Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
  5. 1011725Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)
  6. 1011755Protein Malonamidase E2 [75306] (1 species)
  7. 1011756Species Bradyrhizobium japonicum [TaxId:375] [75307] (12 PDB entries)
  8. 1011771Domain d1obla_: 1obl A: [92761]
    complexed with mla; mutant

Details for d1obla_

PDB Entry: 1obl (more details), 2 Å

PDB Description: crystal structure of the s133a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum
PDB Compounds: (A:) malonamidase e2

SCOPe Domain Sequences for d1obla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obla_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggssagsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

SCOPe Domain Coordinates for d1obla_:

Click to download the PDB-style file with coordinates for d1obla_.
(The format of our PDB-style files is described here.)

Timeline for d1obla_: