Lineage for d1oazl_ (1oaz L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741756Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 2741775Domain d1oazl_: 1oaz L: [92745]
    Other proteins in same PDB: d1oaza_, d1oazb_, d1oazh_, d1oazj_
    part of IgE Fv spe-7

Details for d1oazl_

PDB Entry: 1oaz (more details), 2.77 Å

PDB Description: IgE Fv SPE7 complexed with a recombinant thioredoxin
PDB Compounds: (L:) immunoglobulin e

SCOPe Domain Sequences for d1oazl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oazl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOPe Domain Coordinates for d1oazl_:

Click to download the PDB-style file with coordinates for d1oazl_.
(The format of our PDB-style files is described here.)

Timeline for d1oazl_: