SCOPe 2.04: Domain d1oaeb_: 1oae B:

Lineage for d1oaeb_ (1oae B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c'' [68950] (1 species)
   close homologue of SHP

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (3 PDB entries)

8. Domain d1oaeb_: 1oae B: [92705]
   complexed with gol, hec, so4

Details for d1oaeb_

PDB Entry: 1oae, 1.95 Å

PDB Description: crystal structure of the reduced form of cytochrome c" from methylophilus methylotrophus

PDB Compounds: (B:) cytochrome c"

SCOPe Domain Sequences for d1oaeb_:

Sequence; same for both SEQRES and ATOM records:

>d1oaeb_ a.3.1.1 (B:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kptk

Timeline for d1oaeb_:

• d1oaeb_ first appeared in SCOP 1.67
  
• d1oaeb_ appears in SCOPe 2.03
  
• d1oaeb_ appears in SCOPe 2.05
  
• d1oaeb_ appears in the current release, SCOPe 2.08