SCOPe 2.01: Domain d1o9qa_: 1o9q A:

Lineage for d1o9qa_ (1o9q A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
   possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family)

5. Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)

6. Protein Malonamidase E2 [75306] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [75307] (12 PDB entries)

8. Domain d1o9qa_: 1o9q A: [92683]
   mutant

Details for d1o9qa_

PDB Entry: 1o9q, 1.8 Å

PDB Description: crystal structure of the s155c mutant of malonamidase e2 from bradyrhizobium japonicum

PDB Compounds: (A:) malonamidase e2

SCOPe Domain Sequences for d1o9qa_:

Sequence; same for both SEQRES and ATOM records:

>d1o9qa_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggcvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalaks

Timeline for d1o9qa_:

• d1o9qa_ first appeared in SCOP 1.67
  
• d1o9qa_ appears in SCOP 1.75
  
• d1o9qa_ appears in SCOPe 2.02
  
• d1o9qa_ appears in the current release, SCOPe 2.08