Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (3 species) |
Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries) |
Domain d1o87b1: 1o87 B:1-88 [92642] Other proteins in same PDB: d1o87a2, d1o87b2 protein/RNA complex; complexed with cl, fmt, gdp, mg |
PDB Entry: 1o87 (more details), 2.1 Å
SCOPe Domain Sequences for d1o87b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o87b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d1o87b1: