Lineage for d1o87b1 (1o87 B:1-88)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765693Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 765694Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 765714Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 765725Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 765744Domain d1o87b1: 1o87 B:1-88 [92642]
    Other proteins in same PDB: d1o87a2, d1o87b2
    complexed with cl, fmt, gdp, mo4, mo5

Details for d1o87b1

PDB Entry: 1o87 (more details), 2.1 Å

PDB Description: a new mggdp complex of the ffh ng domain
PDB Compounds: (B:) signal recognition particle protein

SCOP Domain Sequences for d1o87b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o87b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d1o87b1:

Click to download the PDB-style file with coordinates for d1o87b1.
(The format of our PDB-style files is described here.)

Timeline for d1o87b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o87b2