Lineage for d1o6ua2 (1o6u A:275-398)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824591Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold
  4. 2824592Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) (S)
  5. 2824593Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein)
  6. 2824594Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species)
  7. 2824595Species Human (Homo sapiens) [TaxId:9606] [101579] (2 PDB entries)
    Uniprot O76054
  8. 2824599Domain d1o6ua2: 1o6u A:275-398 [92590]
    Other proteins in same PDB: d1o6ua1, d1o6ua3, d1o6uc1, d1o6uc3, d1o6ue1, d1o6ue3
    complexed with plm

Details for d1o6ua2

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor
PDB Compounds: (A:) sec14-like protein 2

SCOPe Domain Sequences for d1o6ua2:

Sequence, based on SEQRES records: (download)

>d1o6ua2 b.132.1.1 (A:275-398) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflktkmgerqragemt
evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekm
kqlg

Sequence, based on observed residues (ATOM records): (download)

>d1o6ua2 b.132.1.1 (A:275-398) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflkerqragemtevlp
nqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekmkqlg

SCOPe Domain Coordinates for d1o6ua2:

Click to download the PDB-style file with coordinates for d1o6ua2.
(The format of our PDB-style files is described here.)

Timeline for d1o6ua2: