Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.2: Terpene synthases [48243] (2 proteins) consists of two toroid domains: one of six and one of five hairpins |
Protein Squalene-hopene cyclase [48244] (1 species) |
Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
Domain d1o6qc2: 1o6q C:37-307 [92582] complexed with c8e, r17 |
PDB Entry: 1o6q (more details), 2.8 Å
SCOPe Domain Sequences for d1o6qc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6qc2 a.102.4.2 (C:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild mtqhpafikgweglelygveldyggwmfqas
Timeline for d1o6qc2:
View in 3D Domains from other chains: (mouse over for more information) d1o6qa1, d1o6qa2, d1o6qb1, d1o6qb2 |