SCOPe 2.08: Domain d1o69a_: 1o69 A:

Lineage for d1o69a_ (1o69 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Aminotransferase homolog WlaK (PglE, Cj1121c) [102603] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [102604] (3 PDB entries)

8. Domain d1o69a_: 1o69 A: [92560]
   structural genomics
   complexed with bme, x04

Details for d1o69a_

PDB Entry: 1o69, 1.84 Å

PDB Description: crystal structure of a plp-dependent enzyme

PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d1o69a_:

Sequence; same for both SEQRES and ATOM records:

>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]}
gnelkyieevfksnyiaplgefvnrfeqsvkdysksenalalnsataalhlalrvagvkq
ddivlassftfiasvapicylkakpvfidcdetynidvdllklaikecekkpkalilthl
ygnaakmdeiveickendivliedaaealgsfyknkalgtfgefgvysyngnkiittsgg
gmligknkekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlk
kreiyewykeflgeyfsfldelensrsnrwlstalinfdknelnacqkdinisqknitlh
pkiskliedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskd
dvyeisklilksik

Timeline for d1o69a_:

• d1o69a_ first appeared in SCOP 1.67
  
• d1o69a_ appears in SCOPe 2.07