Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins) |
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species) there is an additional C-terminal allosteric domain in some species |
Species Thermotoga maritima [TaxId:243274] [102699] (3 PDB entries) |
Domain d1o63a_: 1o63 A: [92540] |
PDB Entry: 1o63 (more details), 2 Å
SCOP Domain Sequences for d1o63a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o63a_ c.94.1.1 (A:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima} lklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadig fcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqryceskg whcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsyr tkreevvsfleklqeviehdsne
Timeline for d1o63a_: