SCOP 1.71: Domain d1o63a_: 1o63 A:

Lineage for d1o63a_ (1o63 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Thermotoga maritima [TaxId:243274] [102699] (3 PDB entries)

8. Domain d1o63a_: 1o63 A: [92540]

Details for d1o63a_

PDB Entry: 1o63, 2 Å

PDB Description: crystal structure of an atp phosphoribosyltransferase

SCOP Domain Sequences for d1o63a_:

Sequence; same for both SEQRES and ATOM records:

>d1o63a_ c.94.1.1 (A:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima}
lklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadig
fcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqryceskg
whcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsyr
tkreevvsfleklqeviehdsne

Timeline for d1o63a_:

• d1o63a_ first appeared in SCOP 1.67
  
• d1o63a_ appears in SCOP 1.69
  
• d1o63a_ appears in SCOP 1.73
  
• d1o63a_ appears in the current release, SCOPe 2.08