SCOP 1.71: Domain d1o57d1: 1o57 D:2-74

Lineage for d1o57d1 (1o57 D:2-74)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)

6. Protein N-terminal domain of Bacillus PurR [101022] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries)

8. Domain d1o57d1: 1o57 D:2-74 [92489]
   Other proteins in same PDB: d1o57a2, d1o57b2, d1o57c2, d1o57d2
   complexed with 1pe, 2pe, epe, p6g, pg4, so4

Details for d1o57d1

PDB Entry: 1o57, 2.2 Å

PDB Description: crystal structure of the purine operon repressor of bacillus subtilis

SCOP Domain Sequences for d1o57d1:

Sequence; same for both SEQRES and ATOM records:

>d1o57d1 a.4.5.40 (D:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis}
kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
vpgaaggvkyipk

Timeline for d1o57d1:

• d1o57d1 first appeared in SCOP 1.67
  
• d1o57d1 appears in SCOP 1.69
  
• d1o57d1 appears in SCOP 1.73
  
• d1o57d1 appears in the current release, SCOPe 2.08