Lineage for d1o57c1 (1o57 C:1-74)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533817Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)
  6. 533818Protein N-terminal domain of Bacillus PurR [101022] (1 species)
  7. 533819Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries)
  8. 533822Domain d1o57c1: 1o57 C:1-74 [92487]
    Other proteins in same PDB: d1o57a2, d1o57b2, d1o57c2, d1o57d2

Details for d1o57c1

PDB Entry: 1o57 (more details), 2.2 Å

PDB Description: crystal structure of the purine operon repressor of bacillus subtilis

SCOP Domain Sequences for d1o57c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o57c1 a.4.5.40 (C:1-74) N-terminal domain of Bacillus PurR {Bacillus subtilis}
mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
tvpgaaggvkyipk

SCOP Domain Coordinates for d1o57c1:

Click to download the PDB-style file with coordinates for d1o57c1.
(The format of our PDB-style files is described here.)

Timeline for d1o57c1: