SCOPe 2.08: Domain d1o4zd1: 1o4z D:58-353

Lineage for d1o4zd1 (1o4z D:58-353)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
   Pfam PF00722
   beta-Glucanase-like

6. Protein beta-Agarase A [101636] (1 species)

7. Species Zobellia galactanivorans [TaxId:63186] [101637] (3 PDB entries)

8. Domain d1o4zd1: 1o4z D:58-353 [92477]
   Other proteins in same PDB: d1o4zb2, d1o4zd2
   complexed with epe, mg, na

Details for d1o4zd1

PDB Entry: 1o4z, 2.3 Å

PDB Description: the three-dimensional structure of beta-agarase b from zobellia galactanivorans

PDB Compounds: (D:) beta-agarase B

SCOPe Domain Sequences for d1o4zd1:

Sequence; same for both SEQRES and ATOM records:

>d1o4zd1 b.29.1.2 (D:58-353) beta-Agarase A {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek

Timeline for d1o4zd1:

• d1o4zd1 first appeared in SCOP 1.67, called d1o4zd_
  
• d1o4zd1 appears in SCOPe 2.07