PDB entry 1o4z

View 1o4z on RCSB PDB site
Description: the three-dimensional structure of beta-agarase b from zobellia galactanivorans
Class: hydrolase
Keywords: beta-agarase, glycoside hydrolase family 16, agarose degradation, cleavage of beta-1, 4-d-galactose linkages
Deposited on 2003-07-29, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-agarase B
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: agaB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o4za_
  • Chain 'B':
    Compound: beta-agarase B
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: agaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RGX8 (Start-337)
      • cloning artifact (338)
    Domains in SCOPe 2.07: d1o4zb1, d1o4zb2
  • Chain 'C':
    Compound: beta-agarase B
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: agaB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o4zc_
  • Chain 'D':
    Compound: beta-agarase B
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: agaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RGX8 (Start-337)
      • cloning artifact (338)
    Domains in SCOPe 2.07: d1o4zd1, d1o4zd2
  • Heterogens: MG, NA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4zA (A:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zA (A:)
    dwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltewk
    rdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwlls
    addtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgt
    vwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgln
    kemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o4zB (B:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zB (B:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o4zC (C:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zC (C:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o4zD (D:)
    mdigdnskfdsatdlpveqeqeqeteqegepeesseqdlveevdwkdipvpadagpnmkw
    efqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatr
    kpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwllsaddtqeidileaygady
    sesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedgtvwnkefhrfgvywrdpw
    hleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtglnkemdiiintedqtwrss
    pasglqsntytptdnelsnienntfgvdwiriykpveklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4zD (D:)
    vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
    krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
    saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
    tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
    nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvekl