Lineage for d1o4ka_ (1o4k A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415905Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 415906Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 415907Family d.93.1.1: SH2 domain [55551] (28 proteins)
  6. 415921Protein c-src tyrosine kinase [55556] (3 species)
  7. 415926Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)
  8. 415932Domain d1o4ka_: 1o4k A: [92462]
    complexed with psn

Details for d1o4ka_

PDB Entry: 1o4k (more details), 1.57 Å

PDB Description: crystal structure of sh2 in complex with pasbn.

SCOP Domain Sequences for d1o4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4ka_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

SCOP Domain Coordinates for d1o4ka_:

Click to download the PDB-style file with coordinates for d1o4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1o4ka_: