Lineage for d1nxd1_ (1nxd 1:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459811Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 459817Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (47 PDB entries)
  8. 459853Domain d1nxd1_: 1nxd 1: [92294]

Details for d1nxd1_

PDB Entry: 1nxd (more details), 1.9 Å

PDB Description: crystal structure of mnmn concanavalin a

SCOP Domain Sequences for d1nxd1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxd1_ b.29.1.1 (1:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1nxd1_:

Click to download the PDB-style file with coordinates for d1nxd1_.
(The format of our PDB-style files is described here.)

Timeline for d1nxd1_: