Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Concanavalin A [49901] (4 species) natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop |
Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (74 PDB entries) Uniprot P81461 |
Domain d1nxd1_: 1nxd 1: [92294] complexed with azi, gol, mn, na |
PDB Entry: 1nxd (more details), 1.9 Å
SCOPe Domain Sequences for d1nxd1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxd1_ b.29.1.1 (1:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d1nxd1_: