Lineage for d1nx9c1 (1nx9 C:435-666)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384249Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 2384250Protein Alpha-amino acid ester hydrolase [89247] (2 species)
  7. 2384251Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)
  8. 2384270Domain d1nx9c1: 1nx9 C:435-666 [92289]
    Other proteins in same PDB: d1nx9a2, d1nx9b2, d1nx9c2, d1nx9d2
    complexed with aic, gol; mutant

Details for d1nx9c1

PDB Entry: 1nx9 (more details), 2.2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase s205a mutant complexed with ampicillin
PDB Compounds: (C:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1nx9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx9c1 b.18.1.13 (C:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

SCOPe Domain Coordinates for d1nx9c1:

Click to download the PDB-style file with coordinates for d1nx9c1.
(The format of our PDB-style files is described here.)

Timeline for d1nx9c1: