Lineage for d1nwsd1 (1nws D:22-260,D:329-383)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440387Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2440484Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 2440485Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 2440503Domain d1nwsd1: 1nws D:22-260,D:329-383 [92259]
    Other proteins in same PDB: d1nwsa2, d1nwsb2, d1nwsc2, d1nwsd2

Details for d1nwsd1

PDB Entry: 1nws (more details), 2.7 Å

PDB Description: crystal structure of human cartilage gp39 (hc-gp39) in complex with chitobiose
PDB Compounds: (D:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1nwsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwsd1 c.1.8.5 (D:22-260,D:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOPe Domain Coordinates for d1nwsd1:

Click to download the PDB-style file with coordinates for d1nwsd1.
(The format of our PDB-style files is described here.)

Timeline for d1nwsd1: