Lineage for d1nwka1 (1nwk A:6-146)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605038Protein Actin [53073] (7 species)
  7. 1605064Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (61 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1605101Domain d1nwka1: 1nwk A:6-146 [92241]
    complexed with anp, ca, rho

Details for d1nwka1

PDB Entry: 1nwk (more details), 1.85 Å

PDB Description: crystal structure of monomeric actin in the atp state
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1nwka1:

Sequence, based on SEQRES records: (download)

>d1nwka1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1nwka1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgiit
nwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiq
avlslyasg

SCOPe Domain Coordinates for d1nwka1:

Click to download the PDB-style file with coordinates for d1nwka1.
(The format of our PDB-style files is described here.)

Timeline for d1nwka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nwka2